Home / Cav2.x Channel Blockers / ω-Agatoxin TK

ω-Agatoxin TK

Catalog #: 2802
5 Citations Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
2802/10U
ω-Agatoxin TK
1 Image
Description: CaV2.1 blocker
Alternative Names: Agatoxin IVB

Purity: ≥95%

Product Details
Citations (5)
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

ω-Agatoxin TK is a selective blocker of CaV2.1 P/Q-type calcium channels.

Technical Data

M.Wt:
5273.02
Formula:
C215H337N65O70S10
Sequence:
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA

(Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34)

Solubility:
Soluble in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
158484-42-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons.
    Teramoto et al.
    Brain Res., 1997;756:225
  2. High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK.
    Barral et al.
    Eur.J.Pharmacol., 2001;430:167
  3. A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels.
    Teramoto et al.
    Biochem.Biophys.Res.Comms., 1993;196:134

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for ω-Agatoxin TK

The citations listed below are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:

5 Citations: Showing 1 - 5

  1. Abnormal excitability and episodic low-frequency oscillations in the cerebral cortex of the tottering mouse.
    Authors: Cramer Et al.
    Neuropsychopharmacology  2015;35:5664
  2. Purkinje cell dysfunction and delayed death in plasma membrane calcium ATPase 2-heterozygous mice.
    Authors: Fakira Et al.
    J Neurosci  2012;51:22
  3. Concurrent imaging of synaptic vesicle recycling and calcium dynamics.
    Authors: Li Et al.
    Front Mol Neurosci  2011;4:34
  4. Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability.
    Authors: Grubb and Burrone
    Mol Cell Neurosci  2010;465:1070
  5. Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation.
    Authors: Maier Et al.
    J Biol Chem  2010;285:35606

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for ω-Agatoxin TK

There are currently no reviews for this product. Be the first to review ω-Agatoxin TK and earn rewards!

Have you used ω-Agatoxin TK?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.