Home / Galanin Receptor Agonists / Galanin (1-30) (human)

Galanin (1-30) (human)

Catalog #: 1179
2 Citations Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
1179/1
Galanin (1-30) (human)
1 Image
Description: Endogenous galanin receptor agonist

Purity: ≥95%

Product Details
Citations (2)
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Galanin (1-30) (human) is a endogenous peptide with multiple endocrine, metabolic and behavioral effects. Has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.

Technical Data

M.Wt:
3157.41
Formula:
C139H210N42O43
Sequence:
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Solubility:
Soluble to 0.50 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
119418-04-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Mechanisms of galanin-induced contraction in the rat myometrium.
    Niiro et al.
    Br.J.Pharmacol., 1998;124:1623
  2. Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide.
    Schmidt et al.
    Proc.Natl.Acad.Sci.U.S.A., 1991;88:11435
  3. Hypothalamic galanin: control by signals of fat metabolism.
    Wang et al.
    Brain Res., 1998;804:7

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for Galanin (1-30) (human)

The citations listed below are publications that use Tocris products. Selected citations for Galanin (1-30) (human) include:

2 Citations: Showing 1 - 2

  1. Dynamic mass redistribution reveals diverging importance of PDZ-ligands for G protein-coupled receptor pharmacodynamics.
    Authors: Camp Et al.
    Pharmacol Res  2016;105:13
  2. Bacteria activate sensory neurons that modulate pain and inflammation.
    Authors: Chiu Et al.
    Nature  2013;501:52

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Galanin (1-30) (human)

There are currently no reviews for this product. Be the first to review Galanin (1-30) (human) and earn rewards!

Have you used Galanin (1-30) (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.