SNX 482

Catalog #: 2945
7 Citations Datasheet / COA / SDS

Catalog #	Availability	Size / Price	Qty
2945/10U

1 Image

Description: Potent and selective CaV2.3 blocker

View All Products for Cav2.x Channel Blockers

Product Details

Citations (7)

Reviews

Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

SNX 482 is a potent and selective, voltage-dependent R-type Ca_V2.3 calcium channel blocker (IC₅₀ = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses.

Technical Data

M.Wt:

4495.01

Formula:

C₁₉₂H₂₇₄N₅₂O₆₀S₇

Sequence:

GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

(Modifications: Disulfide bridge between 7 - 21, 14 - 26, 20 - 33)

Solubility:

Soluble in water

Storage:

Desiccate at -20°C

CAS No:

203460-30-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

Fetal calcium regulates branching morphogenesis in the developing human and mouse lung: involvement of voltage-gated calcium channels.
Brennan, Sarah C, Finney, Brenda A, Lazarou, Maria, Rosser, Anne E, Scherf, Caroline, Adriaensen, Dirk, Kemp, Paul J, Riccardi, Daniela
PLoS ONE, 2013;8(11):e80294.
Interaction of SNX482 with domains III and IV inhibits activation gating of α_1E (Ca_V2.3) calcium channels.
Bourinet et al.
Biophys.J., 2001;81:79
The Ca_V2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain.
Matthews et al.
Eur.J.Neurosci., 2007;25:3561
Selective peptide antagonist of the class E calcium channel from the venom of the Tarantula Hysterocrates gigas.
Newcomb et al.
Biochemistry, 1998;37:15353

Product Datasheets

COA view current batch

Or select another batch:

View Batch

SDS

Reconstitution Calculator

Molarity Calculator

Reconstitution Calculator

Molarity Calculator

Mass

Concentration

Volume

M. Wt* g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for SNX 482

The citations listed below are publications that use Tocris products. Selected citations for SNX 482 include:

7 Citations: Showing 1 - 7

Calcium Channel CaV2.3 Subunits Regulate Hepatic Glucose Production by Modulating Leptin-Induced Excitation of Arcuate Pro-opiomelanocortin Neurons.
Authors: Smith Et al.
Cell Rep 2018;25:278
Direct versus indirect actions of ghrelin on hypothalamic NPY neurons.
Authors: Hashiguchi
PLoS One 2017;12(9):e0184261
σ-1 receptor antagonism restores injury-induced decrease of voltage-gated Ca2+ current in sensory neurons.
Authors: Pan Et al.
Proc Natl Acad Sci U S A 2014;350:290
Fetal calcium regulates branching morphogenesis in the developing human and mouse lung: involvement of voltage-gated calcium channels.
Authors: Brennan Et al.
PLoS One 2013;8:e80294
Miniature IPSCs in hippocampal granule cells are triggered by voltage-gated Ca2+ channels via microdomain coupling.
Authors: Goswami Et al.
J Neurosci 2012;32:14294
Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability.
Authors: Grubb and Burrone
J Pharmacol Exp Ther 2010;465:1070
Competitive regulation of synaptic Ca²⁺ influx by D2 DA and A2A adenosine receptors.
Authors: Higley and Sabatini
Nat Neurosci 2010;13:958

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for SNX 482

There are currently no reviews for this product. Be the first to review SNX 482 and earn rewards!

Have you used SNX 482?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.