Nogo-66 (1-40)

Catalog # Availability Size / Price Qty
1984/1
Nogo-66 (1-40)
1 Image
Description: Competitive antagonist for Nogo-66 receptor; promotes neuron regeneration
Alternative Names: NEP1-40,Nogo Extracellular Peptide,1-40

Purity: ≥95%

Product Details
Supplemental Products
Reviews

Biological Activity

Nogo-66 (1-40) is a peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.

Technical Data

M.Wt:
4625.16
Formula:
C206H324N56O65
Sequence:
RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS

(Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
475221-20-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. The sphingolipid receptor S1PR2 is a receptor for Nogo-a repressing synaptic plasticity.
    Kempf A, Tews B, Arzt M, Weinmann O, Obermair F, Pernet V, Zagrebelsky M, Delekate A, Iobbi C, Zemmar A, Ristic Z, Gullo M, Spies P, Dodd D, Gygax D, Korte M, Schwab M
    PLoS Biol, 2014;12(1):e1001763.
  2. Nogo-66 receptor antagonist peptide promotes axonal regeneration.
    GrandPre et al.
    Nature, 2002;417:547
  3. Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor.
    Liu et al.
    Science, 2002;297:1190
  4. Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury.
    Li and Strittmatter
    J.Neurosci., 2003;23:4219

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs
Loading...

Reviews for Nogo-66 (1-40)

There are currently no reviews for this product. Be the first to review Nogo-66 (1-40) and earn rewards!

Have you used Nogo-66 (1-40)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.