Glucagon-like peptide 1 (1-37) (human, rat)

Catalog # Availability Size / Price Qty
1851/1
Glucagon-like peptide 1 (1-37) (human, rat)
1 Image
Description: Endogenous pancreatic peptide
Alternative Names: GLP-1 (1-37) amide

Purity: ≥95%

Product Details
Citations (1)
Supplemental Products
Reviews

Biological Activity

Glucagon-like peptide 1 (1-37) (human, rat) is a pancreatic hormone synthesized by post-translational processing of proglucagon. Unlike truncated forms of GLP-1, it has no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice.

Technical Data

M.Wt:
4169.52
Formula:
C186H275N51O59
Sequence:
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility:
Soluble to 5 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
87805-34-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Exon duplication and divergence in the human preproglucagon gene.
    Bell et al.
    Nature, 1983;304:368
  2. Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake.
    Navarro et al.
    J.Neurochem., 1996;67:1982
  3. Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into Ins-producing cells.
    Suzuki et al.
    Proc.Natl.Acad.Sci.USA, 2003;100:5034

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citation for Glucagon-like peptide 1 (1-37) (human, rat)

The citations listed below are publications that use Tocris products. Selected citations for Glucagon-like peptide 1 (1-37) (human, rat) include:

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs
Loading...

Reviews for Glucagon-like peptide 1 (1-37) (human, rat)

There are currently no reviews for this product. Be the first to review Glucagon-like peptide 1 (1-37) (human, rat) and earn rewards!

Have you used Glucagon-like peptide 1 (1-37) (human, rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.