Exendin-4

Catalog # Availability Size / Price Qty
1933/1
Exendin-4
1 Image
Description: Potent GLP-1 receptor agonist
Alternative Names: Exenatide,AC 2993

Purity: ≥95%

Product Details
Citations (8)
Supplemental Products
Reviews

Biological Activity

Exendin-4 is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); originally isolated from Heloderma suspectum venom. Exendin-4 potently induces cAMP formation without stimulating amylase release in pancreatic acini. Potentiates glucose-induced insulin secretion in isolated rat islets. Exendin-4 protects against glutamate-induced neurotoxicity, and in a mouse model of metabolic imblance it reduces neuroinflammation and enhances long-term-potentiation.

Technical Data

M.Wt:
4186.61
Formula:
C184H282N50O60S
Sequence:
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

(Modifications: Ser-39 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
141758-74-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. A programmable synthetic lineage-control network that differentiates human IPSCs into glucose-sensitive insulin-secreting beta-like cells
    P Saxena, BC Heng, P Bai, M Folcher, H Zulewski, M Fussenegge
    Nat Commun, 2016;7(0):11247.
  2. The Hypothalamic Glucagon-Like Peptide-1 (GLP-1) Receptor (GLP-1R) is Sufficient but Not Necessary for the Regulation of Energy Balance and Glucose Homeostasis in Mice
    Melissa A Burmeister
    Diabetes, 2016;0(0):.
  3. Expansion and conversion of human pancreatic ductal cells into insulin-secreting endocrine cells.
    Lee J, Sugiyama T, Liu Y, Wang J, Gu X, Lei J, Markmann J, Miyazaki S, Miyazaki J, Szot G, Bottino R, Kim S
    Elife, 2013;2(0):e00940.
  4. Defined three-dimensional culture conditions mediate efficient induction of definitive endoderm lineage from human umbilical cord Wharton's jelly mesenchymal stem cells

    Stem Cell Res Ther, 2016;7(1):165.
  5. Hindbrain oxytocin receptors contribute to the effects of circulating oxytocin on food intake in male rats.
    Ho J, Anekonda V, Thompson B, Zhu M, Curry R, Hwang B, Morton G, Schwartz M, Baskin D, Appleyard S, Blevins J
    Endocrinology, 2014;155(8):2845-57.
  6. Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4.
    Perry et al.
    J.Pharmacol.Exp.Ther., 2002;302:881
  7. Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of Ins-Secr.g β-cells.
    Goke et al.
    J.Biol.Chem., 1993;268:19650
  8. Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.
    Thorens et al.
    Diabetes, 1993;42:1678
  9. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom.
    Eng et al.
    J.Biol.Chem., 1992;267:7402

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for Exendin-4

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs
Loading...

Reviews for Exendin-4

There are currently no reviews for this product. Be the first to review Exendin-4 and earn rewards!

Have you used Exendin-4?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.